1 Subcategories:Titles:Summaries:
Neurological Conditions 20Neurological Disorders: Support & InformationResources focus on providing support and information for individuals living with various neurological conditions and their families. Many sites detail specific disorders like Multiple Sclerosis, Parkinson’s Disease, and Amyotrophic Lateral Sclerosis, offering personal stories and research updates.
154 Websites:Organisations:Summaries:Related categories:Related keywords:Related locations:
huaxingtang.nlDutch Association for AcupunctureAcupuncture has a preventative effect and positively impacts a person’s well-being, by strengthening the natural resistance, increasing the pain threshold, and stimulating vitality. The acupuncturist analyzes both physical and emotional aspects of the complaint, providing insight into the causes and potential solutions, with attention to the impact of habits and nutrition. Acupuncture is suitable for a wide range of conditions, including complaints in the musculoskeletal system, nervous system, skin, respiratory system, cardiovascular system, digestive system, mental disorders, and urinary and genital organs.Disease & Treatment → Diseases 829 traditional chinese medicine 97 condition 425 acupuncture 1537 wellbeing 2620 health 6366 complaint 6479
igla.nlIglaThe website describes Igla as an alternative care practice in Baarn and Utrecht, focused on providing preventative and therapeutic therapies. It provides an overview of different acupuncture variations such as auriculotherapy, moxibustion, and guasha, as well as other therapies such as NES Health and BEMER® Vascular Therapy. The website highlights the applications of acupuncture for various complaints, including pain, respiratory complaints, gastrointestinal problems, menstrual problems, sleep problems, and emotional complaints, and offers support to patients with post-COVID complaints, cancer, and fatigue.acupuncture 1537 pain 1919 body 3490 health 6366 complaint 6479 therapy 7448 Utrecht → Baarn 1628
natuurgeneeskundehoogvliet.nlSolvia HealthThe website introduces Joyce Tak as a CAM therapist who offers a variety of treatment methods tailored to the individual needs of the client. The site describes various treatment methods, including Muscle Testing, Psych-K, Homeopathy, Bach Remedies, Nutritional Advice, and Foot Reflexology. The website also includes a blog with recent news and information about foot reflexology and chakra reflexology, emphasizing the role of energy balance in promoting health.Alternative Medicine → Complementary Therapies 858 Disease & Treatment → Diseases 829 disease 285 foot reflexology 597 therapist 1890 balance 4582 treatment 21203
pilliewillie.nlWillyThe website covers various aspects of orthomolecular medicine, including the relationship between knowledge, power and health, as well as the role of orthomolecular supplements. Articles are presented on specific topics, such as the potential risks of folic acid during pregnancy, the influence of blue light on sleep, and a new treatment method for osteoarthritis. The website also contains information about collaborations with orthomolecular doctors and therapists, and offers various language options, including English, Dutch, French and Spanish.Alternative Medicine → Orthomolecular Medicine 340 glucosamine 17 osteoarthritis 53 orthomolecular medicine 62
crisisbeheersingnederland.nlCrisisbeheersing NederlandThe website presents various topics, including information about knee pain and diagnosis. A foldable tent (easy up tent) is promoted as a convenient and versatile solution for outdoor activities. The website offers a loan simulation tool and introduces a personal trainer in Oosterhout.Management → Crisis Management 92 knee pain 14 crisis management 110 personal trainer 136 loan 832 North-Brabant → Oosterhout 2086
wellspect.nlWellspectWellspect Benelux offers products such as LoFric catheters and Navina bowel cleansing systems, aimed at improving the daily lives of users with bladder and bowel problems. The website contains information about various bladder and bowel disorders, their causes, treatments, and how to manage these conditions. Wellspect offers services for healthcare professionals and patients, educational resources, and support through Wellspect Assistance and a wide range of topics, including sustainability and research.bowel 14 bladder 19 healthcare professionals 235 patient 4082
prospan.nlProspanThe website describes Prospan as a cough syrup with the ‘power of ivy’ and claims to be effective against all types of coughs, including tickle cough and persistent cough. The platform provides information about coughs, their causes, and tips for combating the symptoms, with attention to different application areas such as travel and school. Prospan is available in both stick pack and bottle form, specially designed for adults and children (depending on the form), and contains a unique Prospan Ivy extract EA575*.ivy 10 cough 18 extract 41 bottle 300 tips 2789
hulpmiddelenwijzer.nlVilansThe website categorizes assistive devices by activity, such as communication, eating and drinking, household tasks, relaxation, personal care, caregiving, mobility and transportation, work and study, and living. A list of specific conditions, such as ADHD, stroke, COPD, dementia, diabetes, and spinal cord injury, is linked to assistive devices suitable for these situations. The site provides tips and practical information about choosing the right assistive devices and what to consider when making your selection.Social Services → Seniors 822 device 698 choice 827 's-Hertogenbosch → Southeast 168
dooozz.nlDOOOZzDOOOZz has been supplying radiation protection for 10 years, including 5G, focusing on EHS and insomnia, and is often praised for its good price-to-performance ratio. The products are handmade using natural and organic materials and utilize ingredients that have been used for centuries in Ayurveda and TCM, to convert radiation influences into life energy (orgon). The website introduces a new product line called DOOOZz Thelema, which ‘intoned’ specific frequencies into bionite, creating a static orgon field, and offers support for home, on the go, and at night.Pediatric & Child Health → Sleep Problems 266 radiation 94
skafit.nlSkafitThe website offers a wide range of products, including silver socks, anti-sweat socks, warm legwear, silver clothing, thermal underwear, silver gloves, and wool products. Customers can benefit from high customer satisfaction (9.2 based on over 1100 reviews) and personal customer service from foot specialists. The website highlights the benefits of silver in sports socks, such as antibacterial properties, temperature regulation, and moisture management, and introduces the Ionic+ anti-sweat underwear.Clothing → Socks 237 underwear 281 silver 479 wool 489 socks 489
boekenoverziekten.nlboekenoverziekten.nlThe website contains books about various diseases, including cancer. A book, 'Eighth Graders Don't Cry' by Jacques Vriens, deals with the impact of illness, specifically leukemia, on an eighth-grade class and their school year. The purpose of the books is to help readers talk about diseases, especially when these topics are sensitive.Knowledge → Culture 82659 disease 285 class 2076 book 11396
stralendaanzee.nlPraktijk Stralend aan ZeeThe website describes an approach focused on restoring the function of genes, hormones, and nutrition through a Back-on-Track program and a Start program. A blog is available with relevant information about health and lifestyle. The website offers a free e-book to inform visitors and an opportunity for a free information call.Emergency & Safety → Alternative Healthcare 567 gene 36 nutrition 4935 complaint 6479 blog 13392
healthandscience.nlhealthandscience.nlThe website publishes articles about depression, including information on natural prevention and treatment methods, emphasizing the role of good nutrition for the nervous system. Research shows that a high intake of folic acid, primarily through supplements, can reduce the risk of glaucoma by lowering homocysteine levels in the blood. Chromium yeast can alleviate symptoms of type 2 diabetes and vitamin D during pregnancy can lead to stronger babies with more muscle mass.Anatomy & Systems → General Health 105 vitamin d 38 depression 408 diabetes 750
lactastic.nlFreedom to Choose B.V.The website highlights the personal motivation behind developing the lactase tablets, stemming from the experiences of those with lactose intolerance. Lactastic produces its own high-quality lactase tablets without additives in the Netherlands, and ships them with free shipping for orders placed before 4 PM. The website provides various information about lactose intolerance, lactose-free recipes, and FAQs, as well as a shop with different dosages of lactase tablets.Disease & Treatment → Allergies 157 intolerance 16 tablet 998 ship 5103 recipe 5142 Utrecht → Oudewater 475
bowentherapeut.nlPaul van HolsteijnFasciatherapy, also known as bowentherapy, is a treatment method that stimulates the body's own healing ability and is effective for various ailments. The website describes the applications of the technique on complaints such as neck and back pain, arm and shoulder pain, injuries, breathing problems, fatigue, foot and ankle pain, and joint pain, as well as with stress complaints. Patients can share their experiences and potential customers are invited to contact Paul van Holsteijn for a free consultation and appointment.Physical Therapy → Fascia Therapy 13 fascia therapy 45 therapist 1890 pain 1919 complaint 6479 energy 9075 appointment 13510 Gelderland → Ede 5104
dokter.nlDokter.nlThe website offers a wide range of information on various health topics, including diseases, treatments, prevention, and specific cases like atopic eczema or thrombosis. Users can also find news on relevant topics such as coronavirus, alcohol, drugs, and allergies, as well as information about prevention programs. The website also contains self-tests for anxiety disorders, BMI, and hyperventilation, and discussions on topics such as reimbursement for mobility scooters and recognizing scabies.Disease & Treatment → Diseases 829 scootmobile 21 test 769 question 2261 health 6366
alopecia-vereniging.nlAlopecia VerenigingThe association is a network of volunteers offering support for various forms of alopecia. The website provides information on alopecia, treatments, experiences, and relevant topics such as hair prosthetics and reimbursement. Furthermore, the association organizes activities, including congresses, workshops, swimming days, and walks, to connect and inform people with alopecia.Social Organization → Patient Organizations 259 alopecia 19 magazine 2182 association 8562 South-Holland → Leiden 7089
healthcarechain.nlHealthCareChainThe website sells a wide range of supplements, including vitamins and products targeted at specific health issues such as diabetes, joints, and mental health. The website provides informative articles and reviews about various health products and conditions, such as L-Theanine, arthrodesis, Brain Actives, and fibromyalgia. In addition, practical tips and exercises are offered, for example, for maintaining supple hands and coping with fibromyalgia.Anatomy & Systems → General Health 105 fibromyalgia 43 supplement 1968 reviews 3172 health 6366
glutenvrij.nlNCVThe website offers medical information about celiac disease, including forms, figures, symptoms, disease progression, and genetics. It contains a section with frequently asked questions, information about diagnosis and treatment, with guidelines on the gluten-free diet and references to dietitians. Furthermore, the website provides an overview of products, recipes, tips for baking and cooking, and information specifically aimed at young people with celiac disease.Nutrition → Diets 951 celiac disease 12 gluten free 12 diet 747 diagnosis 1490 recipe 5142
ikbenglutenvrij.nlMirjam HollemanThe website contains articles about celiac disease, what gluten-free eating means, facts and figures about the condition, and helpful lists. It also offers gluten-free maps and recipes, as well as links to relevant blogs and stores selling gluten-free products. The website features personal stories from Mirjam and Mirthe about their experiences with celiac disease and living gluten-free, and provides updates on the website's restoration.Cooking & Recipes → Gluten-Free 41 celiac disease 12 gluten-free 156 recipe 5142 article 6000
natterman.nlImgroma BVNatterman is an expert in cough treatment and offers solutions for the whole family, including specific products for dry and persistent coughs. The website emphasizes the safety of Natterman cough syrup, stating that the products are not produced in India and do not contain ethylene glycol or diethylene glycol, in response to news reports about toxic ingredients. Natterman offers a wide range of products for throat and airway problems, and customers can order directly or obtain information and advice.Pharmaceuticals & Medical Products → Medications 232 throat 16 cough 18 syrup 54
volle-maan.nlVolle Maan CommunicatiebureauThe agency carries out communication projects with a focus on reaching a wide range of patients and professionals in the healthcare sector. Volle Maan stands for emancipation, particularly for people with a disease or disability, and emphasizes the importance of being well-informed as a first step. The team consists of five professionals with different fields of expertise and works on projects that are specifically tailored to the target group, such as magazines, animated films, and informative meetings.Social Issues → Public Health 167 Disease & Treatment → Diseases 829 target group 578 meeting 2381 health 6366 communication 10162
detoxplein.nlDetoxpleinThe website contains articles on various health-related topics, such as nutrition, detoxification, and conditions like osteoporosis and menstruation. There are recipes, reviews of products (such as menstrual cups and water filter pitchers), and discussions on topics such as collagen and astaxanthin. The website provides a platform for sharing tips and information on health and wellness.Nutrition → Healthy Eating 634 detoxification 29 collagen 193 nutrition 4935 recipe 5142
foodless.nlFoodlessThe website offers a wide variety of gluten-free and dairy-free recipes, categorized into sections such as breakfast, brunch, lunch, and desserts. It also features a blog with articles about gluten-free terms, including information on celiac disease and pregnancy. Visitors can purchase a gluten-free cookbook from Foodless and the website provides various social media links for connection.Cooking & Recipes → Gluten-Free 41 gluten-free 156 cookbook 260 recipe 5142 blog 13392
ncv.nlDutch Coeliac AssociationThe website provides information about developments and activities surrounding the gluten-free diet, including the presentation of a subsidy for gluten-free awareness in healthcare institutions. The NCV organizes various activities, such as craft workshops, workshops, and cycling events, to support research into coeliac disease and raise awareness. The website offers the opportunity to become a member, volunteer, and find information about dieticians and relevant services, such as an online shop and knowledge center.Social Organization → Patient Organizations 259 dietician 56 gluten-free 156 volunteer 8367 research 8967 membership 10442 The Hague → Leidschenveen-Ypenburg 395
revolutionairgezond.nlN.V. (implied)The website offers free downloads, blogs, and a knowledge base providing information on nutrition and lifestyle for hypothyroidism and Hashimoto’s. Online programs are offered to reduce symptoms and improve energy and well-being in people with these conditions. Special cookbooks provide healthy recipes tailored to the nutritional needs of individuals with hypothyroidism and Hashimoto’s, to increase energy and reduce stress.Nutrition → Healthy Eating 634 cookbook 260 symptoms 558 lifestyle 2918 nutrition 4935 energy 9075
melodydrost.nlMelody DrostMelody Drost offers individual coaching (1:1 programs) for women with endometriosis and digestive problems, focusing on reducing symptoms and promoting a healthier lifestyle. The website describes various programs, including 'Endometriosis Intensive 1:1', 'Endometriosis Kickstart 1:1' and 'Gut Healing 1:1', which are tailored to specific symptoms and needs. Additionally, she offers an online course ('PMS Proof') and free downloads to inform and support visitors. The approach is personal, practical, and focused on sustainable change.Pregnancy & Childbirth → Women’s Health 968 endometriosis 26 digestive issues 44 lifestyle 2918 nutrition 4935 course 14728
lynch-polyposis.nlLynch Polyposis FoundationLynch syndrome and Polyposis are inherited conditions that increase the risk of colon cancer and other cancers, often leading to the development of numerous polyps. The foundation focuses on identifying, connecting, and informing individuals impacted by these conditions, offering support and peer connections. Genetic testing is essential to determine if someone is a carrier of Lynch syndrome or Polyposis, and referrals to university medical centers are provided for this testing.Diseases → Cancer 546 genetic testing 10 cancer 631 foundation 6678
bnpparibasmarkets.nlBNP ParibasThe website is owned and managed by BNP Paribas S.A., a French bank headquartered in Paris. The website contains information about financial products issued by BNP Paribas, RBS plc, and RBS N.V., and is intended for personal use and informational purposes. Users are requested to carefully read and accept the terms and conditions before using the website, with emphasis on legal obligations.Contract Law → General Terms 16 Banking & Payments → Banking 361 term 251 bank 374 legal 937 regulation 1350
otrivin.nlHaleon Netherlands B.V.The website addresses various symptoms related to colds, flu, sinusitis, and hay fever, and offers recommendations on how Otrivin can help with stuffy noses. Otrivin Xylometazoline is described as a medication that works quickly and provides long-lasting relief from nasal congestion. The website contains information on where to purchase Otrivin, frequently asked questions, product brochures, and links to privacy policies and terms and conditions.Pharmaceuticals & Medical Products → Medications 232 cold 31 symptoms 558 medication 1164
marfansyndroom.nlMarfan and Related Conditions Contact Group NetherlandsThe website describes Marfan syndrome as a congenital and hereditary connective tissue disorder with various symptoms affecting the heart, blood vessels, eyes, and skeleton. Information is available for patients, family members, and friends, with a focus on understanding and coping with the condition. The website also contains information for professionals such as doctors, physiotherapists, and nurses, including a multidisciplinary guideline and informational resources.guideline 344 symptoms 558 community 7931
tietze.nlTietze VerenigingThe website includes information about the symptoms, causes, and treatments of these conditions. There are various sections for members, including a member login, contact for members, training courses, questions for doctors and a youth page. Additionally, the website offers news, articles, an activities calendar, videos, a private Facebook and Whatsapp group, and opportunities to become a member, make a donation, and apply for vacancies.community 7931 member 10154 training 28133
dieetbehandelingsrichtlijnen.nlBSL Media & LearningThe website contains over fifty guidelines, which are based on the latest scientific insights and provide a clear translation to practice. The guidelines are written by dietitians for dietitians and document standardized processes in a scientific dossier. Recent updates include revised guidelines for Celiac disease, COPD, and type 1 diabetes, as well as guidelines adapted with the Flemish government for Belgian dietitians.Nutrition → Dietetics 816 disease 285 dietitian 299 guideline 344
dutchpainsociety.nlDutchpainsociety.nlPain is defined as a complex sensory experience with varying intensity, ranging from unpleasant to unbearable, and as a warning signal in acute pain and as a disease in chronic pain. The perception of pain in animals is difficult to determine, based on the transfer of human experiences and dependent on the differences in their nervous systems. The annual cost of painful conditions amounts to approximately one billion euros in developed countries, highlighting the impact of pain on healthcare.pain 1919 cost 1990 animal 2908
herbalkneepatch.nlWellneeKnee pain, such as arthritis and overexertion, are widespread musculoskeletal problems that can diminish quality of life. The Wellnee Patch combines traditional herbal medicine with modern technology to support joint health and mobility. The patch contains eight potent plant ingredients with proven effectiveness. The patch utilizes transdermal absorption to deliver the active substances directly to the affected area of the knee joint, with ingredients such as mugwort, ginger oil extract, radix aconiti, capsaicin, saffron, camphor, cinnamon and menthol & borneo.Naturopathy → Herbal Medicine 99 patch 42 inflammation 51 knee 66 herbs 924 ingredients 2346 health 6366
geneeshetzelf.nlGenees het ZelfThe site covers a wide range of conditions, including hemorrhoids, acne, Candida, hair growth, rosacea, and warts. Authors, such as Boris, share tips and information about different treatments, such as the use of natural substances and supplements, and freezing warts at home. The platform focuses on self-care of health problems through natural methods and providing information on topics such as hearing loss and thyroid problems.Emergency & Safety → Natural Medicine 763 warts 17 ailments 135 mask 381 supplement 1968 health 6366
ectodermaledysplasienederland.nlEctodermale DysplasieEctodermal dysplasia encompasses various types, each caused by specific genetic mutations. There is no specific treatment for ectodermal dysplasia, but symptoms can be managed to improve quality of life. The website describes different variations of ectodermal dysplasia and offers suggestions for addressing specific symptoms, such as using wigs, artificial dentures, and artificial tears.Dermatology → Skin Diseases 17 gene 36 variation 75 symptoms 558 skin 2518
thc-store.nlTHC SklepThe website advertises a range of THC products including marijuana, hash, edibles, and crystal forms like Krystalina THC and MoonRock THC. Customers receive free shipping for orders exceeding 300 PLN with an additional 100 PLN gift, or free shipping and a 100 PLN gift for orders above 500 PLN. The store emphasizes discretion, secure shipping, and fast delivery times (maximum 5 business days). They also claim to be the first Polish online THC store serving the entire European Union.marijuana 10 thc 27 ship 5103 gift 6442
diabetes-suikerziekte.nlOnbekendThe site covers health advice, with a focus on nutrition and the prevention of diabetes. The article describes type 2 diabetes as a chronic condition that can be reduced by adopting a healthy lifestyle with a balanced diet and exercise. The website provides practical tips on nutrition, including the importance of a varied diet, whole grains, lean protein, and healthy fats, as well as avoiding processed foods and limiting sugar intake.sugar 100 exercise 706 diet 747 diabetes 750 nutrition 4935
politiekplatform.nlPolitiek PlatformThe website offers a step-by-step explanation of the process of DIY installing plastic frames in De Lier, including preparation and finishing. The article discusses the challenges of a DIY installation and the benefits, such as cost savings and personal satisfaction. Another article discusses osteoarthritis (artrose), a degenerative joint condition, including the causes, symptoms, and genetic factors.Windows → Frames 1211 cartilage 14 osteoarthritis 53 frames 2556 installation 13742 Westland → De Lier 404
philippereuser.nlPhilippereuserThe website covers topics such as Mounjaro (tirzepatide) as a potential solution for managing blood sugar and weight loss, and the popularity of ordering HHC vapes. It contains articles about conditions such as fibromyalgia, keratoconus, and the impact of these conditions on daily life. Furthermore, the site provides information about nutrition, hair growth (with Batana oil) and cosmetic procedures such as fillers under the eyes.Anatomy & Systems → General Health 105 Disease & Treatment → Diseases 829 keratoconus 12 hhc 18 batana oil 24 fibromyalgia 43 filler 293
gezondbezig.nlGezond Bezig B.V.The website covers a wide range of health topics, including allergies, anti-aging, bladder infections, dry skin, flu and cold, air pollution, sleep, sports, training, quitting smoking, and financial health. There's special attention paid to various conditions such as arthritis (in different parts of the body), rheumatism, diabetes, cholesterol, breast cancer, depression, burnout, osteoporosis, STIs, and menopause. Furthermore, the website provides information on nutrition, vitamins, superfoods, diets (including crash diets and Paleo), recipes, and natural treatments, with a focus on lowering blood pressure and cholesterol without medication and slowing down the aging process.Mind & Body → Self-Care 698 anti aging 26 cholesterol 43 blood pressure 53 sport 4228 nutrition 4935 health 6366
tagatose-info.nlDamhertTagatose is a natural sugar substitute developed by Damhert, a Belgian producer, and now used in various food products. The product offers several benefits, including a low calorie value, a prebiotic effect, a glycemic index of zero, and is tooth-friendly and not laxative. The website emphasizes that Tagatose is suitable for diverse groups, including diabetics and people seeking a healthier sweetener.Chronic Diseases → Diabetes 349
vodiservice.nlVodiServiceThe website covers various topics, including nutrition, diet, diseases (such as celiac disease, diabetes, and cancer), and (top) sports. VodiService was founded by Katrien Blaauw and Anne Wipkink, two renowned dietitians who combine practical experience and scientific knowledge to provide up-to-date information. A unique feature of VodiService is the ability to directly contact a specialized dietitian online for questions and advice.Disease & Treatment → Diseases 829 disease 285 dietitian 299 diet 747 sport 4228 nutrition 4935
metrechthelder.nlMetRechtHelder B.V.Janneke has taken a work sabbatical to reflect on her business model and complete her master's philosophy studies. During this sabbatical, she will also pursue creative projects, such as giving concerts. MetRechtHelder B.V. offers services related to drafting general terms and conditions, including visual and comic-form representations.Contract Law → General Terms 16 creative project 16 sabbatical 21 general terms and conditions 35
pruikenkapper.nlPruikenkapper.nlThe website presents a wide range of hairpieces, including wigs, toppers, toupets, and hair extensions. The company specializes in fitting and creating hairpieces for clients with hair loss, such as alopecia or as a result of chemotherapy. Pruikenkapper.nl offers a free initial consultation and handles the claim procedure with the health insurance provider, and has its own workshop where everything is made by hand.Hair Accessories → Wigs 10 topper 92 hairpiece 153 wig 210 insurance 6359 assortment 7799 workshop 19325
zuur-base-evenwicht.nlzuur-base-evenwicht.nlThe acid-base balance plays a crucial role in various conditions, including gout, rheumatism, kidney disorders, osteoarthritis, and gastrointestinal issues. The website emphasizes that many people do not understand the link between these conditions and the acid-base balance. By consuming basic foods and maintaining a healthy lifestyle, the acid-base balance can be restored and improved, allowing the body to function optimally.Anatomy & Systems → General Health 105 disease 285 diet 747
hoofdpijntips.nlhoofdpijntips.nlThe website covers different types of headaches, such as cluster headaches, migraines, tension headaches, headaches due to medication, and headaches due to poor eyesight. Information is available on the causes of headaches, such as an irregular eating and sleeping pattern, and about which medications are often used. The website states that it is advisable to contact a doctor if you have persistent headaches and advises keeping a headache diary.migraine 84 headache 182 diary 212 medication 1164
anamel.nlAnamelThe website provides information about various conditions around the anus, such as hemorrhoids, anal fissures, diaper rash, and skin irritation. AnaMel, the honey balm, is described as a product that relieves pain, itching, and irritation, and restores the skin around the anus. Customer testimonials from users like Miranda, Ada, and Esther confirm the effectiveness of the balm in treating hemorrhoids, fissures, and irritation.irritation 14 hemorrhoids 15 wound healing 17 skin 2518
baoshi.nlBao ShiThe practice, founded in 2016 by Christa Hesseling, focuses on treating headaches, migraines, stress, neck and shoulder pain, and other head-related issues, with a further specialization in migraines and chronic headaches in 2023. Christa Hesseling is an HBO-V nurse, registered acupuncturist and TuiNa massage therapist with experience in treating a variety of complaints, including stress, burnout, anxiety, and exam anxiety. The practice uses various treatment methods, including classical acupuncture, ear acupuncture, TuiNa massage and cupping, in consultation with the client. An estimate of the number of treatments needed is provided.Physical Therapy → Pain Therapy 936 Mental & Emotional Well-Being → Anxiety 1169 ear acupuncture 23 migraine 84 neck pain 138 acupuncture 1537 stress 3965 treatment 21203
hetsoftwarehuis.nlHetSoftwareHuisThe general terms and conditions of HetSoftwareHuis regulate the service provided between the company and the customer (Client). The terms specify topics such as offers, payments, ownership, liability, and dispute resolution. The company is located in Amsterdam and is registered in the Handelsregister.Contract Law → General Terms 16 Contracts → Conditions 13 general terms and conditions 35 agreement 1029 Limburg → Maastricht 6008
guusta.nlGuustaThe website publishes articles on various health issues, such as depression, burnout, anxiety, migraine, and insomnia. Alternative therapies and treatments for these conditions are also described. The website also covers topics such as food allergies, pet allergies, and their symptoms, with a focus on tips for parents of children with allergies.Health → Blogs 17 allergy 254 depression 408 symptoms 558 recipe 5142 health 6366 therapy 7448
mamatotaal.nlMamatotaal.nlThe website features articles on practical tips for mothers, such as laundry tips, gender-neutral parenting, and information about health issues like varicose veins. Additionally, Mamatotaal.nl offers suggestions for creating a family-friendly garden with trees, tips for maintaining swimwear, and advice on quality clothing at a good price. The website encompasses various categories including General, Children, Lifestyle, Fashion, Shopping, Home, Animals and Hobbies.Parents → Mothers 135 fashion 2212 health 6366 clothing 9443 child 11566 garden 13129
fmdgroep.nlFMDgroepFibromuscular dysplasia is a condition that can cause narrowing, aneurysms, or ruptures in blood vessels, potentially leading to symptoms like high blood pressure and strokes. The website contains information on symptoms, diagnosis, treatment, patient folders, and a glossary of terms related to FMD. It also offers information about medical research, presentations, and an archive of older materials, as well as peer support through Facebook groups.blood vessels 23 symptoms 558 research 8967
sulfree.nlHeatXPSul Free, developed by vinologist Jacqueline Niesten, provides a solution to reduce headaches caused by sulfites in wine by converting sulfites into harmless sulfates. The Daikin Comfora air conditioner is designed for comfort and energy efficiency and offers both cooling and heating, utilizing the environmentally friendly R-32 refrigerant. HeatXP offers heat pump installations in Almere, focusing on energy efficiency and sustainability, as an alternative to traditional heating systems.Climate Control → Air Conditioning 1022 air conditioner 408 heat pump 2541 wine 4476
apotheekwaluwezaltbommel.nlStadsapotheek Zaltbommel & Apotheek de WaluweThe website offers information about common conditions such as COPD, diabetes, heart failure, asthma, and hay fever. The Zaltbommel and de Waluwe pharmacies offer a repeat prescription service where they request prescriptions from the patient’s general practitioner and prepare the medication. The website describes information meetings and service days that the pharmacies organize annually, where topics such as diabetes, asthma and cardiovascular diseases are discussed.Pharmaceuticals & Medical Products → Pharmacies 1029 condition 425 general practitioner 508 medication 1164 Zaltbommel → Gameren 83
doorbreekdecyclus.nlDoorbreken de CyclusThe site shares stories and experiences of individuals with HMB and other menstrual issues, and offers a menstrual check and podcast episodes. The site covers conditions such as menopause, endometriosis, PMDD, fibroids, POI, and PCOS, discussing their symptoms and impact. The website emphasizes the need to speak more about menopause symptoms and encourages visitors to initiate conversations about these topics.Women’s Health → Menstruation 50 bleeding 12 endometriosis 26 menstruation 65 menopause 219 symptoms 558
sperti.nlHaleon Netherlands B.V.Sperti is available without a prescription at various retailers, such as pharmacies, drugstores, and online. Hemorrhoids can cause discomfort and irritation, and Sperti is often used to treat these issues. The website is exclusively intended for residents of the Netherlands and contains information about the product leaflet for Sperti medicines.Pharmaceuticals & Medical Products → Medications 232 hemorrhoids 15 medicine 435
vanhultenelastischekousen.nlVan HultenThe website provides information about various compression aids, such as therapeutic elastic stockings, Velcro bandages, and compression trousers, which are used to prevent and combat edema. The website explains the functionality of Velcro bandages as self-adjustable systems that help reduce fluid buildup and describes the goals of compression trousers, which support edema in various body parts. The website emphasizes the importance of proper donning and doffing instructions and provides information about meeting locations and customer service, highlighting compression therapy as a passion.Fashion → Underwear 774 compression 50 stockings 86 bandage 98 edema 141
steunkousendeurne.nlAngèle Therapeutic Elastic Stockings (TEK)Therapeutic elastic stockings can alleviate leg and arm pain, and the website highlights the expertise of Angèle Therapeutic Elastic Stockings (TEK) in Deurne. The website states that a referral from a doctor is required to obtain the stockings, and a specialist can measure the stockings personally and answer questions. The practice emphasizes privacy and complies with the AVG (GDPR) regulations regarding the processing of personal data and medical files.Health → Medical Care & Services 29461 elastic stockings 17 referral 377 measurement 731 privacy 1286 North-Brabant → Deurne 1329
dietistenpraktijksleegers.nlDiëtistenpraktijk SleegersThe practice treats a wide range of complaints and conditions, including COPD, diabetes, obesity, heart and blood vessel diseases, and digestive problems. Evi Sleegers, the dietitian, emphasizes a positive approach to nutritional advice, focusing on what is allowed and encouraging a healthy lifestyle. The practice offers a low-threshold approach, flexible contact, and works with other healthcare providers, such as physiotherapists and general practitioners, and in 2025 offers the possibility of reimbursement of dietary advice from the basic insurance.Nutrition → Dietetics 816 condition 425 diet 747 lifestyle 2918 nutrition 4935 treatment 21203 coach 25810 North-Brabant → Deurne 1329
eiproducten.nlEiproducten.nlThe site publishes scientific news about eggs, cholesterol, and eggs in a healthy diet, gathered from research conducted by Wulro.nl. It shows that eating eggs, within a varied diet, is not necessarily unhealthy, by emphasizing the balance between good and bad cholesterol. The website also discusses the amount of eggs people consume annually and the way eggs are often hidden in processed foods.Nutrition → Diets 951 cholesterol 43 egg 335 diet 747 research 8967
bijniergeenbijzaak.nlNVACPThe website describes what an Addison crisis is and its symptoms, such as a drop in blood pressure and loss of consciousness. It emphasizes the importance of daily cortisol-replacement medication during extra stress and the possibility of a crisis during significant events. The website sells and promotes an emergency kit with medications and an automotive seatbelt pouch containing medical data and the European emergency card, specifically targeted for people with Addison's disease.emergency kit 37 medication 1164
emotieweb.nlEmotiewebThe website identifies challenges in a child's social-emotional development by pinpointing deficiencies and comparing scores to a normative group. Emotieweb maps out various aspects of social-emotional development, such as recognizing emotions and demonstrating empathy. The test battery is specifically designed for deaf, hard-of-hearing, children with autism spectrum disorders, and children with language development disorders, but is also suitable for other children with concerns about their development.Pediatric & Child Health → Developmental Disorders 24 test 769 child 11566
trombosegids.nlTrombosegidsThe website covers various aspects of thrombosis, including what thrombosis is, the symptoms associated with it, and its causes. A chapter is dedicated to the risks of thrombosis when flying, mentioning ‘traveler thrombosis’ and highlighting the doubling to quadrupling of the risk. The website also discusses a holistic lifestyle and the concept of holism, as defined by Jan Christiaan Smuts, and its contrast with dualistic approaches.Sports & Fitness → Flight Training 93 thrombosis 14 compression stockings 24 fly 143 holism 168
ireneboonstoppel.nlIrene BoonstoppelThe website offers an overview of services, including appointment scheduling and free online consultations. Blogs are published with exercises and information focused on reducing stress and addressing underlying energy imbalances. The website recognizes that complaints are often deeper-rooted than physical and offers an approach focused on the subtle energy within the body.Anatomy & Systems → General Health 105 thyroid 28 exercise 706 body 3490 stress 3965 complaint 6479 energy 9075
kniecare.nlKniecareThe practice provides various treatments, including one-time consultations, sports injury treatments, and second opinions, focusing on helping patients achieve their goals. Furthermore, the website offers free resources such as a knee osteoarthritis check, 5 free exercises, a webinar, and a knowledge base with exercises and videos. The Knieartrose Community offers a training program, ‘Your Knee Osteoarthritis Boss,’ which provides a step-by-step plan to reduce knee pain and live a more active life.Podology → Orthopedics 1525 exercises 1058 community 7931 treatment 21203 training 28133 Gelderland → Nijmegen 9384
decocare.nlDecoCareThe website offers information and tools focused on preventing pressure ulcers, such as bedding, heel protectors, and cushions. In addition to pressure ulcer prevention, the website focuses on improving user comfort through a variety of categories including beds, care products, and clothing. DecoCare offers a wide range of aids, including an online store with special prices and highlighted products for healthcare professionals and patients.Household & Cleaning → Household Goods 1642 healthcare professionals 235 aid 427 comfort 1473 care 12338
dietistenpraktijkenschede.nlDiëtistenpraktijk EnschedeThe practice, run by Maggy Owel, has three locations in Enschede and specializes in disorders of the digestive system, as well as nutrition in the context of kidney and cancer diseases. The dietitian provides personalized advice and guidance, with the patient's wishes and lifestyles at the center, and strives to achieve desired results with small changes to diet, such as lowering blood values. In addition to individual guidance, the dietitian offers information about nutrition to groups, including the movement GLI Beweegkuur and healthcare providers, to highlight the role of nutrition.Nutrition → Dietetics 816 condition 425 results 3954 nutrition 4935 treatment 21203 Overijssel → Enschede 5554
algemenevoorwaardenvoorbeeld.nlAlgemene Voorwaarden VoorbeeldThe website emphasizes the importance of complying with Dutch law for website owners, particularly the need for general terms and conditions. The general terms and conditions generator is designed to simplify the creation of general terms and conditions, especially for users without prior experience. Users can edit and download the generated terms and conditions, and then place them on their website or send them to customers. The website also provides a link to a privacy policy generator.Contract Law → General Terms 16 Legal Documents → Conditions 41 company name 25 general terms and conditions 35 generator 101
trombosecommunity.nlTrombose CommunityThe platform offers a forum where users can share their stories and ask questions. Users can register and log in to participate in discussions and connect with fellow sufferers. The website contains practical information, rules, and discussion topics to promote user engagement.Internet → Forums & Communities 1599 thrombosis 14 forum 1362 story 8285
ellahaarwerk.nlEllaHaarWerkPeople can unexpectedly experience hair loss due to stress, illness, or hormonal changes. EllaHaarWerk offers hairworks, wigs, and other head coverings, and is a recognized entity in the Groene Hart Ziekenhuis in Gouda, with a long history of experience. The studio offers professional assistance in a quiet and private environment, and can be visited in Gouda or Moordrecht.Hair Care → Hair Loss 94 hairwork 75 wig 210 hair loss 242 hair salon 717 hairdresser 1372 studio 5465 Zuidplas → Moordrecht 332
bic-achterhoek.nlBIC AchterhoekThe website addresses the issue of gout in the foot, where pain is often unbearable and disruptive. Voortman Group offers various career opportunities for ambitious professionals and emphasizes the impact of a well-designed office space on team productivity. The website explores the relevance of printed books in a digital era and describes the technique of welding processes and the function of spring wires in various industries.Economy → Employment & Labor 6059 welding 1051 career 2513 office 2898 book 11396
schroththerapie.nlSchroth Therapie Eindhoven en HelmondThe Schroth method is a three-dimensional treatment method specifically for scoliosis, successfully applied in Germany and gaining popularity in the Netherlands due to positive results. The Schroth method aims to correct the spine, slow down the progression of scoliosis, improve posture, and reduce pain, often without the need for a brace or surgery. The SEAS method, developed in Italy, focuses on active self-correction of scoliosis through exercises and correct postures, and is focused on ongoing scientific development.Physical Therapy → Exercise Therapy 354 scoliosis 20 spine 125 posture 548 exercises 1058 North-Brabant → Eindhoven 11845
deontbrekendeschakel.nlStichting De Ontbrekende SchakelThe foundation aims to raise awareness of this metabolic disease by informing the medical world and support agencies. They distribute information and brochures about the disease to promote faster diagnoses and treatments. The foundation also provides a platform for other parents and caregivers to share their experiences.syndrome 21 caregiver 1167 diagnosis 1490 North-Brabant → Breda 9003
zorglive.nlZorgliveThe website contains articles on topics such as lipoedema treatment, increasing independence with a mobility scooter, and caring for abrasions. Zorglive also offers information about the benefits of physiotherapy and organizing medical cabinets. There are also articles about health and well-being, such as tips for getting through the summer with a radiant appearance.Legal & Financial & Career → Health Insurance 519 lipoedema 20 health insurance 287 physiotherapy 4688
jawell.nlJAWELLThe practice, led by Ineke Leeuwenhoek, provides treatments for conditions such as tension, overload, fatigue and pain, considering both physical and mental causes. Psychosomatic physiotherapy differs from traditional physiotherapy by also influencing the mental and social factors that cause, maintain, and exacerbate the complaints. The practice is affiliated with the KNGF and NFP and offers referrals via the GP, but appointments can also be made without a referral. The location is on the Laan van Meerdervoort in The Hague.Physiotherapy → Psychosomatic Physiotherapy 38 tension 354 mind 514 pain 1919 balance 4582 practice 9089 treatment 21203 The Hague → Loosduinen 395
koelvest.nlCoolvesten.nlCooling vests are used by people who experience excessive warmth, including individuals with Multiple Sclerosis, construction workers, motorcyclists, and healthcare personnel. The assortment includes various types of vests, tailored to specific needs, such as protective clothing for motorcyclists and vests with airflow for ventilation. Wearing cooling vests offers several benefits, including reducing symptoms in people with MS, improving concentration for workers, and extending work hours and reducing accidents for motorcyclists.multiple sclerosis 39 motorcyclist 84 concentration 109 healthcare professionals 235 ventilation 1110
watisdiabetes.nlwatisdiabetes.nlThe website answers questions about what diabetes is, the differences between type 1 and type 2, and how diabetes manifests in young and old people. The website explains that diabetes is a condition in which the body cannot effectively regulate blood sugar levels, often due to a lack of insulin or a resistance to insulin. The website describes the consequences of diabetes, such as high blood sugar levels, high blood pressure, and high cholesterol, and emphasizes the need for quick treatment.insulin 21 blood sugar 30 diabetes 750
nooyencare.nlNooijen CareThe practice is certified and staffed with a qualified mammacare advisor and SEMH certification, highlighting the expertise and attention to the customer. Originally part of a long-standing lingerie store in Oosterhout, the practice was continued in 2006 as a specialized breast prosthesis practice. The practice offers a private and comfortable environment for customers, with a focus on expert advice and personalized attention when selecting the right breast prosthesis.Underwear → Lingerie 471 mammacare 14 breast prosthesis 41 lingerie 488 practice 9089 North-Brabant → Oosterhout 2086
happy-gut.nlHappyGutThe website describes a common problem: individuals with various complaints that are deemed ‘unexplained’ by doctors and not further treated. HappyGut offers a diagnostic method that goes beyond physical tests and examines the entire lifestyle of the patient, using techniques such as IHHT and infrared therapy. The website provides information on various treatment methods, packages, rates, and the intake procedure. The costs of different consultations are also listed.Alternative Medicine → Functional Medicine 34 symptoms 558 plan 2566 lifestyle 2918 nutrition 4935 research 8967 treatment 21203
onlylifestyle.nlOnlyLifestyleThe website introduces the concept of 'returning to basics' as a lifestyle that’s a gift to oneself, especially for those feeling overwhelmed by society. Articles are presented about career paths after 40, including government encouragement of lifelong learning and career changes. There’s information about hemorrhoids, their causes and symptoms, and an explanation of the function of a vitality coach (vital oog).Specialized Medical Services → Specialized Care 384 hemorrhoids 15 life coach 49 vitality 1726 career 2513 lifestyle 2918
dietistenpraktijk-eindhoven.nlDiëtistenpraktijk EindhovenThe practice helps patients with weight loss by offering advice on dietary patterns and lifestyle changes, even if previous attempts haven’t been successful. Individuals experiencing abdominal cramps, bloating, or diarrhea, potentially related to PDS (Irritable Bowel Syndrome), can benefit from dietary advice and targeted support. For patients with conditions like COPD or cancer, tailored nutrition and potentially feeding solutions are provided to prevent weight loss and optimize energy intake.Nutrition → Dietetics 816 pds 27 dietician 56 weight loss 678 nutrition 4935 North-Brabant → Eindhoven 11845
margreetdik.nlMargreet DikMargreet Dik has been specializing in compression therapy and mammacare in Zuidlaren for 30 years and is SEMH-certified, demonstrating her expertise and qualifications. The website provides information on therapeutic elastic stockings and compression aids for vascular conditions and lymphedema, as well as compression clothing for preventing scars and lymphedema. In the area of mammacare, Margreet Dik offers fittings of breast prostheses, special lingerie and swimwear for patients with breast cancer, and for problem fit bras.Cancer → Breast Cancer 100 mammacare 14 elastic stockings 17 lymphedema 24 compression therapy 27 breast prosthesis 41 Tynaarlo → Zuidlaren 445
algemene-voorwaarden-webshop.nlGeneral Terms and Conditions WebshopThe website offers information and support for creating important legal documents for webshops, including general terms and conditions, privacy policies, and disclaimers. It emphasizes the importance of general terms and conditions for businesses and explains why they are essential for minimizing risks. The website provides answers to questions about what general terms and conditions are, why they are needed, and how they can be drafted.Contract Law → General Terms 16 Privacy → Privacy Policy 27 general terms and conditions 35 privacy policy 122 webshop 8648
horecagokkast.nlH&H BVThe company, H&H BV, specializes in distributing, operating, and supplying new slot machines to hospitality business owners. Horeca Gokkast serves a wide area in the Netherlands, including provinces such as North Holland and South Holland. The website offers a contact option and information about services such as the placement of slot machines and gaming machines.Events & Hospitality → Hospitality Services 57 gaming machine 10 gaming machines 19 slot machine 27 operation 480 netherlands 1376 hospitality 3491 Netherlands → South-Holland 92382
henksap.nlHenk Sap Kinesiologie MassageThe practice offers various massage forms, including relaxation massage, sports massage, cupping massage, volcano massage, kinesiotherapy, Ayurveda, cranial sacral massage, and kinesiotaping. The practice also treats lipoedema through compression stockings, lipobreakers, LPG treatments, massages, drops and lasers. Positive results are reported regarding the treatment of lipoedema, with centimeters of fat reduced and pain decreased, with the hope of further assistance for other patients.Physical Therapy → Chiropractic 420 lipoedema 20 kinesiotherapy 39 back pain 373 massage 7646 treatment 21203 South-Holland → Delft 5309
heerlijkwellness.nlRedactieThe website features articles on topics such as hair growth (Batana oil), gout, relaxation, music for salons, and luxury hotel rooms with saunas. The portfolio includes blog posts about infrared cabins, diode laser equipment, double washbasin vanities, and natural care products. The website has categories like ‘General’, ‘Living’ and ‘Blog’ and is published by the editorial team.Animals → Dogs 5879 Disease & Treatment → Diseases 829 spa 355 wellness 1561 article 6000
twenty5.nlTwenty5The document defines key terms used, such as Twenty5, Client, and Agreement. These general terms and conditions apply to all offers, quotes, and agreements between Twenty5 and its clients, outlining the rights and obligations of each party. Offers made by Twenty5 are initially non-binding, becoming binding only upon written confirmation by the client, with any modifications requiring mutual agreement.Associations & Groups → Business Associations 1018 agreement 1029
compressiewijzer.nlThuasne Benelux B.V.The website contains information on various types of compression aids, such as night compression, sports and medical compression clothing, and bandages, as well as advice on their use and maintenance. Users can use a finder to contact a specialist in their area who can advise them on the appropriate type of compression products and the correct fit. The website also provides tips and information about problems with compression aids and how to solve them, as well as experiences from users and professionals.Medical Devices → Lymphedema 10 stockings 86 bandage 98 specialist 938
astaxanthine-info.nlAstaxanthine-InfoAstaxanthin is a powerful antioxidant and free radical scavenger, similar to vitamin E and beta-carotene, but with additional benefits such as anti-inflammatory and immune-boosting effects. The website provides information about the applications of astaxanthin, including reducing inflammation, promoting muscle recovery, and protecting the eyes. The website offers free advice on astaxanthin and health, and answers questions about choosing a quality astaxanthin product.antioxidant 36 inflammation 51 health 6366
organic-supplements.nlOrganic-SupplementsThe website sells natural supplements, including Montmorency cherry capsules and Cistanche tubulosa, and provides blog posts on various health topics. A recent article describes the importance of restoring vaginal flora for women’s health, while another article highlights the benefits of Cistanche tubulosa. The website also introduces a concentration supplement called ‘Concentration Supplement Pro’ as a solution for mental focus, and promotes the benefits of organic Shilajit mumijo.Emergency & Safety → Natural Medicine 763 concentration 109 supplement 1968
novamundo.nlNova MundoThe website provides information about various training opportunities, including a professional training, an assistant training and blended learning courses. Information is available on current final terms, a courtesy scheme for substitute learners and educational tools. Nova Mundo also offers opportunities for continuing education, internships and finding vacancies for compression therapists and learners.stockings 86 course 14728 training 28133 North-Holland → Hoorn 3090
ventek-kousen.nlVentek Therapeutic arm & leg stockingsThe website offers various types of stockings, sock detergent, donning and doffing aids, and bandages, including under- and upper-limb bandages. Ventek works with all major health insurance providers and handles the administrative processing with the customer's insurance. The company is certified by the Stichting Erkenningsregeling leveranciers Medische Hulpmiddelen (SEMH) and is a member of Thekon (Therapeutic Stockings Organization Netherlands).Pharmaceuticals & Medical Products → Medical Devices 388 stockings 86 bandage 98 certification 3380 insurance 6359
ipctherapie.nlDoove Care GroepIPC Therapy is a proven therapy that utilizes a pneumatic compression pump and cuffs to treat lymphedema. The website offers information on the operation, indications, contraindications, benefits, scientific basis, and application procedure of IPC Therapy. In addition to information for patients, the website provides resources for therapists and information about the Lymphastim, an advanced compression system, and an overview of the organization Doove Care Group.Pharmaceuticals & Medical Products → Medical Devices 388 lymphedema 24 compression 50 South-Holland → Waddinxveen 1046
annemarievogel.nlAnnemarie VogelThe practice treats a variety of complaints such as digestive problems, weight changes, high blood pressure, depression, and eczema through personalized nutritional therapy. Orthomolecular medicine, derived from the Greek terms 'orthos' (right) and 'molecular,' focuses on optimizing health by adding the right nutrients to the diet. The website provides information about orthomolecular medicine, how it works, and is aimed at people with various health problems and a desire for a healthier lifestyle.Alternative Medicine → Orthomolecular Medicine 340 nutrients 139 lifestyle 2918 nutrition 4935 health 6366 complaint 6479 therapy 7448
kansplusrijnstreek.nlCentrum voor OntwikkelingsstoornissenThe center is dedicated to excellence and innovation within a community based on respect, friendliness, and open communication. Developmental disorders are serious, chronic conditions caused by mental or physical limitations that require lifelong support. The staff consists of licensed internal doctors and nurse practitioners.Social Issues & Welfare → Disability Services 949 barrier 140 staff 3405 community 7931
dietist-echt-susteren.nlVOEDING&DIEET Echt-SusterenThe practice specializes in nutritional counseling and dietary guidance for various conditions and patient groups. The website contains information about the dietitians, the process, and the possibility of home visits. Recent news concerns the relocation of the practice to the Houtstraat.Nutrition → Dietetics 816 dietitian 299 referral 377 condition 425 diet 747 nutrition 4935 treatment 21203
gluten-check.nlTestjezelfAn estimated 250,000 people in the Netherlands and Belgium have celiac disease, but only 10% are diagnosed. A large portion of celiac disease patients experience symptoms for years without a diagnosis. The website provides a test to identify whether symptoms are related to gluten intolerance or celiac disease, emphasizing the importance of early diagnosis and a gluten-free diet in case of a confirmed diagnosis.Disease & Treatment → Allergies 157 celiac disease 12 gluten 20 symptoms 558 diet 747 test 769
steunkousenadvies.nlSteunkousenadviesThe website offers services such as home visits, leg measurements, and bandaging therapy. Various types of therapeutic elastic stockings and compression aids are offered, including stockings for legs and arms, and accessories. The website describes the importance of compression aids for fluid buildup in arms, especially after lymph node removal, and emphasizes the service-oriented and expert approach of the supplier.Pharmaceuticals & Medical Products → Medical Devices 388 therapeutic 12 compression 50 stockings 86 bandage 98 home visit 120 diagnosis 1490
fckendometriose.nlEndometriosis Foundation of the NetherlandsThe website offers articles, personal experiences, tips, and lifestyle content about endometriosis and related conditions like adenomyosis. It also includes medical articles, film recommendations, and podcast suggestions related to endometriosis. The website encourages women to support each other and is linked to the Endometriosis Foundation of the Netherlands and French President Macron, who highlight the condition as a social problem.Pregnancy & Childbirth → Women’s Health 968 endometriosis 26 awareness 1735 film 3007 podcast 3328 article 6000
claessenstultiens.nlClaessen Stultiens compression & careThe website presents the profiles of three consultants: Madeleine Moser, Nicole Smulders, and Marcella van Vliet, who specialize in compression therapy. The site describes the background and expertise of the consultants, mentioning their experience in nursing and dermatology. Information is provided about the services offered, including home visits and the use of therapeutic elastic stockings, with an emphasis on personalized attention and care.Pharmaceuticals & Medical Products → Medical Devices 388 elastic stockings 17 compression therapy 27 home visit 120 consultant 706
cbd-guide.nlCBD GuideThe website covers topics such as the application of CBD for conditions like endometriosis, Alzheimer’s disease, epilepsy, anxiety, cancer, Lyme disease, arthritis, depression, migraine, and sleep problems. Various methods of CBD use are discussed, including CBD flowers, CBD oil, and CBD cosmetics, with attention to production, quality, and legal aspects (such as CBD legislation in the Netherlands). The website also offers information on the differences between CBD and THC, the role of the endocannabinoid system, and the history of hemp, as well as different cannabinoids and quality labels.Culture → Science 5261 endometriosis 26 hemp 65 sleep problems 219 cbd 237
oefentherapie-borger.nlOefentherapie Cesar/MensendieckThe practice offers paramedical care, where clients learn to move and live a healthier lifestyle by using customized exercises. The website addresses various conditions such as stress, pain, sleep problems, and Multiple Sclerosis, describing their causes and symptoms. Oefentherapie Borger employs qualified paramedical therapists and adheres to the standards set by the VvOCM.Movement & Posture → Psychosomatic Medicine 76 multiple sclerosis 39 physical therapy 64 sleep problems 219 posture 548 pain 1919 movement 2304
maatzorgflevoland.nlMaatzorgFlevolandThe website offers blogs on subjects such as stopping alcohol consumption, comparing health insurance plans and avoiding surprises, the use of cupping in Amsterdam, and the treatment of keratoconus. There are also articles on other healthcare-related themes, including post-operative care after a neck lift, car adaptations for people with disabilities, and effective physiotherapy for hamstring injuries. The blog also features a job board for the healthcare sector via the website Jouwzorgbaan.nl.Disease & Treatment → Medical Information 305 keratoconus 12 alcohol 150 health insurance 287 cup 648 physiotherapy 4688 car 10865
carin-kinesio.nlKinesiologiepraktijk Carin JansenCarin Jansen began her career in kinesiotherapy in 1999 with balancing as a hobby, but later grew into a full-fledged practice after graduating from TOPKI and being registered with the NSK. In addition to the standard courses Touch For Health and Stress Release, Carin Jansen has developed her own courses under the name Espavo, including Espavo Remedies, which forms an HBO-level recognized training. The practice offers treatments for a wide range of complaints, such as allergies and stress-related problems, using muscle tests and the Espavo method, and is affiliated with professional associations, allowing treatments to be potentially reimbursed.Alternative Medicine → Kinesiotherapy 30 kinesiotherapy 39 health insurance 287 balance 4582 complaint 6479 course 14728
kurz-ttrshop.nlLEONHARD KURZ Benelux B.V.These terms apply to all offers, deliveries of films and related services, including application services for decorated parts. Offers from KURZ are valid for only 45 days from the date of the offer, unless explicitly agreed otherwise in writing. Prices are non-binding and exclusive of VAT and other government charges, based on delivery ex works according to Incoterms® 2010.Legal Documents → Conditions 41 Law → Terms 39 term 251 condition 425 order 6912 price 8328
praktijkarianda.nlAriandaThe website describes several treatment methods, including cranio sacral, integrated embryonic therapy, foot reflexology, ear acupuncture, and primary reflex therapy. Clients often experience chronic complaints that are difficult to diagnose and treat, and the website offers solutions for these problems. The website presents success stories of clients who have experienced improvements after treatment, such as restoring movement and reducing pain and concentration problems.Alternative Medicine → Cranio Sacral Therapy 188 ear acupuncture 23 cranio sacral therapy 25 life coach 49 foot reflexology 597 body 3490 complaint 6479
acupunctuurcastricum.nlAcupunctuur CastricumAcupuncture can help with various complaints, such as neck and shoulder pain, headaches, arthritis, hay fever, overactive bladder, and sports injuries. Arjan Lehman de Lehnsfeld is the owner and acupuncturist of the practice, and is a member of the NVA. He offers both acupuncture and fasciatherapy. The website emphasizes the results-oriented approach of the practice and the possibility of reimbursement from health insurance for treatments.Physical Therapy → Pain Therapy 936 fascia therapy 45 health insurance 287 acupuncture 1537 pain 1919 complaint 6479 treatment 21203 North-Holland → Amsterdam 41253
endonatuurlijk.nlEndoNatuurlijkThe website offers an overview of experiences from people with endometriosis who have successfully used natural methods. It informs visitors about the possibilities of natural remedies for endometriosis, including avoiding medication or surgery and promoting an active lifestyle. EndoNatuurlijk emphasizes the importance of taking control of one's own health and making informed choices.Emergency & Safety → Natural Medicine 763 endometriosis 26 methods 481 symptoms 558 choice 827 life 2673 health 6366
mesologiepraktijkfassaert.nlMesology Practice FassaertMesology is a complementary healing method focused on improving quality of life by removing obstacles within the body. It can be a supplement to conventional medicine for complaints such as lung or heart problems, skin problems, migraines, chronic diseases, and burnout. The website provides information about the complaints treated by a mesologist and about how mesology works. Patricia Fassaert, the mesologist, offers contact options for questions and further explanation. A fragment of an interview with Zuidwest TV about her book ‘A Different Perspective on Your Health’ is available to view on the website.Alternative Medicine → Mesology 107 Complaints & Symptoms → Complaints 437 mesology 90 complaint 6479 book 11396
mesologie-beuningen.nlPraktijk voor Mesologie BeuningenThe website contains explanations about Mesology, a form of medicine that combines conventional and alternative knowledge. Visitors can find information about what Mesology can mean for them and what a mesologist can do. Astrid van Zwambagt–de Werd, the mesologist, offers contact options via the website and refers to general terms and conditions and privacy statements.Alternative Medicine → Mesology 107 mesology 90 terms and conditions 118 treatment 21203 Gelderland → Beuningen 883
vaginale-schimmel.nlvaginale-schimmel.nlVaginal yeast infections have increased rapidly in recent decades among women, with standard treatments primarily focused on symptom relief. The site also explores the influence of diet, beverages, and lifestyle on Candida, alongside alternative treatments for managing vaginal yeast infections, highlighting the importance of restoring the body’s acid-base balance. Information on Candida diets and the role of Candida Albicans in maintaining gut flora are provided to help prevent and treat vaginal yeast infections.Women’s Health → Gynecology 37 candida 15 diet 747 treatment 21203
verbasingoververzuring.nlVerbasing over VerzuringThe website contains information about the impact of a sour dietary pattern and lifestyle on the body, such as a reduced immune system and lower energy levels. The book summarizes the insights of Florentine van Vollenhoven, collected over 25 years, about the acid-base principle. The website targets specific groups, including people with stress, fatigue, obesity, chronic illnesses, inflammation, and seniors.target group 578 wellbeing 2620 lifestyle 2918 energy 9075 book 11396
dehypermobieleergo.nlMobile ErgoThe website describes the mobile ergo as a service for people with hypermobility disorders, providing expert advice and guidance. The website features a blog with articles on various aspects of hypermobility, such as wheelchair advice, reviews of assistive devices, and questions about reimbursements from the UWV or WMO. The practice sees dozens of clients weekly with (h)EDS and other conditions involving hypermobility, emphasizing the importance of progression and reaching a stable level of symptoms.healthcare provider 474 blog 13392
haarwerkenfriesland.nlteamharryhummelThe salon, teamharryhummel, is expert in hair loss caused by various factors, including chemotherapy, medication, and hormonal changes, and offers both ready-to-wear and custom-made hairpieces. Teamharryhummel offers hairpieces for women and men, focused on concealing hair loss and boosting confidence and beauty. The salon also provides a service where the hair stylists come to the customer’s location, making the experience as comfortable as possible.Hair Care → Hair Extensions 282 hairpiece 153 hair loss 242 salon 5541 De Fryske Marren → Joure 689
slcn.nlStichting Lymfologie Centrum NederlandIn 1995, the Drachten Lymphoedema Working Group was founded in Nij Smellinghe Hospital, with the aim of improving the diagnosis and treatment of lymphatic edema patients. The SLCN organizes education and training in lymphatic care, in collaboration with the Netherlands Para-medical Institute (NPi) since 2015. The foundation has undertaken various activities, including publishing the first Dutch-language book on lymphatic edema (‘Lymphoedema in practice’) and contributing to international research and guidelines for bandaging.Disease & Treatment → Chronic Diseases 1168 lymphoedema 10 lipoedema 20 bandage 98 guideline 344 research 8967 training 28133 Smallingerland → Drachten 2052
healthyburcht.nlHealthyburchtThe website focuses on offering coaching for women who daily experience symptoms related to the chronic disease endometriosis. Healthyburcht offers services such as personalized guidance for coping with the physical and emotional aspects of endometriosis, customized nutrition advice, and stress management techniques. The website mentions a vacation closure from July 19th to August 3rd, 2025, and provides contact information and a medical disclaimer.Disease & Treatment → Chronic Diseases 1168 endometriosis 26 stress management 58 nutrition 4935 coach 25810 North-Brabant → 's-Hertogenbosch 8868
varicorin.nlN/AVaricorin contains a unique strengthening formula that supports blood circulation, reduces swelling, and promotes the excretion of excess water, resulting in more beautiful legs. The product uses ingredients such as Venocin®, Centellin® and vitamin C from hawthorn extract, which have been scientifically proven to be effective in combating varicose veins and edema. The advanced composition of Varicorin influences various aspects of blood vessel health and is based on clinical trials that demonstrate the effectiveness of the ingredients.Disease & Treatment → Medical Conditions 47 varicose veins 30 edema 141 circulation 155 supplement 1968 ingredients 2346 health 6366
yogabijkanker.nlN.V.The website introduces yoga as a method for regaining trust in one's body and finding emotional peace during times of uncertainty. It describes how yoga can help regain trust after a cancer diagnosis and offers questions to determine if yoga is suitable for the visitor. The website offers 1-on-1 coaching sessions and a blog, encouraging visitors to contact for a free consultation.ACT & EMDR → Hypnosis 566 self 355 cancer 631 peace 1113 trust 1147 body 3490 yoga 3704
anitahaarwerken.nlAnita HaarwerkenThe salon offers free initial consultations to find the best solution for individual customers, considering their needs and wishes. Anita Haarwerken specializes in creating hairpieces for various situations, including chemotherapy, Alopecia Areata, and burns. The salon has a wide assortment of hairpieces, turbans, trendy fabrics, and hats, and is affiliated with all insurance providers.Hair Education → Hair Products 612 hairpiece 153 wig 210 hair 3014 salon 5541 Gelderland → Nijmegen 9384
quadrivastreatment.nlQuadrivas Clinic HarlingenThe clinic focuses on individuals who have already tried various treatments without success, often due to a serious disruption of blood flow. Quadrivas Therapy uses unique, deep manual scraping and hooking techniques to fully restore blood vessels and improve microcirculation. The method is a complete body treatment aimed at the collaboration of vascular, neurological, lymphatic and biomechanical systems to heal the body.blood vessels 23 blood flow 29 body treatment 63 indication 164 therapy 7448 Friesland → Harlingen 978
frisshaarwerken.nlFriss Haarwerken & WigsThe website describes the services offered by Friss Haarwerken, namely the offering of wigs and wigs. The website explains that the company focuses on people experiencing hair loss and supports them in maintaining their identity. The website highlights the expertise of certified hair stylist Ariëtte van Friss Haarwerken, recognized by the ANKO-Wig Specialist.Hair Care → Hairpieces 18 wig 210 hair loss 242 identity 1028 certification 3380 North-Brabant → Etten-Leur 1366
gutvibes.nlGut VibesThe website features pathways and blogs on health and well-being, including information on celiac disease and gluten-free diets. Free tips, webinars, and a toolkit for celiac disease are offered. The website provides online courses, personal coaching, and resources to support the journey to healing and vitality.Nutrition → Special Diets 20 gluten free 12 gut health 62 wellbeing 2620 energy 9075 course 14728 coach 25810 Utrecht → Veenendaal 2641
quadrivasnieuwwest.nlQuadrivas Clinic Nieuw-WestThe therapy is used for conditions such as lipoedema and is intended to activate blood vessels and improve circulation. The website describes various symptoms that can arise from poor circulation, such as heavy legs, pain, cramps, and bruising. Quadrivas Therapy is presented as a natural, activating, and healing treatment that stimulates the self-healing power of the body.Anatomy & Systems → Vascular Diseases 10 blood vessels 23 circulation 155 symptoms 558 body 3490 therapy 7448 energy 9075
quadrivasrotterdam.nlQuadrivas Clinic RotterdamQuadrivas Therapy is a manual treatment method that utilizes specialized techniques to treat various conditions, including lipoedema, lymphatic oedema, and vascular insufficiency. The therapy works by applying deep scraping and hooking techniques, activating the microcirculation and improving blood flow to various tissues in the body. Quadrivas Therapy promotes a complete reset of the body by enhancing oxygen and nutrient delivery to cells.blood flow 29 circulation 155 condition 425 technique 2157 body 3490 therapy 7448 South-Holland → Rotterdam 25048
anuschkahallers.nlAnuschkaThe website describes the origin of the collaboration between Anuschka and Renate, both of whom have experience with NEI and Yoga, and initially focused on making incontinence discussible. NEI is a therapy that focuses on the cause of the complaint, using a biotensor to connect with the subconscious and integrate emotions that feed the complaint. The website emphasizes that incontinence is a widespread problem in the Netherlands (over 1 million people) and that there are different causes and forms of the condition.Energy Work → Emotional Therapy 144 incontinence 37 biotensor 39 nei 109 emotion 2169 yoga 3704
liansleven.nlThema CubeThe site contains a collection of recipes, ranging from sauces and soups to side dishes and salads, with detailed preparation methods and ingredient lists. Furthermore, there is a section dedicated to personal stories, including a description of the fibromyalgia diagnosis and the author's experiences with this condition. The website has categories for recipes such as sauces, soups, side dishes, and salads, as well as archives of recent posts and comments.Dishes → Soups 87 cucumber 35 fibromyalgia 43 egg 335 soup 1043 sauce 1141 recipe 5142
acupunctuurnijboer.nlAcupuncture Nicolien NijboerThe website explains acupuncture and the principles of Traditional Chinese Medicine, where health is seen as a free-flowing energy. Acupuncture is presented as a holistic approach that considers the body, mind, and emotions as a whole and can be applied to various complaints, including pain, hormone problems, and burnout. The website describes how acupuncture works, using needles to unblock energy flows and enable the body to heal itself. Specific treatments are also mentioned.Alternative Medicine → Traditional Chinese Medicine 803 needle 166 holistic 699 acupuncture 1537 body 3490 complaint 6479 energy 9075 Groningen → Haren 805
capilares.nlCapilaresVascular therapy focuses on improving the circulation of the microcirculation, the network of the smallest blood vessels. The therapy supports the body’s self-healing ability by optimizing the supply of nutrients and oxygen to tissues and organs. Improved circulation can alleviate symptoms such as pain and have a positive effect on various conditions, including injuries, migraines, and back pain.Anatomy & Systems → Specific Conditions 205 blood vessels 23 circulation 155 symptoms 558 body 3490 therapy 7448
checkleefstijl.nlErasmus University Medical Center RotterdamThe questionnaire focuses on aspects such as diet, exercise, stress, and alcohol consumption. It was developed in collaboration with experts and follows current guidelines. Users can register to stay updated when the questionnaire becomes available.Business Software → Online Tools 396 alcohol 150 exercise 706 diet 747 lifestyle 2918 stress 3965
goedevoedingenzo.nlGoede Voeding & ZoThe website describes the services offered by Goede Voeding & Zo, including orthomolecular therapy, nutritional advice, and diagnostic tests such as neurotransmitter tests and fat tests. The website specifically focuses on treating complaints such as digestive issues, Lyme disease, long-covid, hay fever, stress complaints, and various joint complaints. The website emphasizes a personalized approach and finding the cause of the complaints, using nutritional advice, lifestyle advice, and potentially supplements and phytotherapy.Alternative Medicine → Complementary Therapies 858 digestive issues 44 diagnostics 687 lifestyle 2918 nutrition 4935 complaint 6479 therapy 7448 Gelderland → Barneveld 2781
haarstudiojose.nlHaarstudio JoséThe salon was founded in 2009 by José Barendse – Raijmakers, who has been working as a hairdresser since her youth. Since 2015, she has been recognized as a certified hairpiece specialist, following the increasing demand for hairpieces in her salon. Haarstudio José offers both hair salon services for men, women, and children, as well as hairpieces in various models and colors, with expert advice and personal guidance.Hair Care → Hairpieces 18 hairpiece 153 hair salon 717 hair 3014 salon 5541 Geertruidenberg → Raamsdonk 124
justjordy.nlJustjordyThe website describes the role of an orthomolecular therapist, who helps people find a healthy lifestyle. The website presents various diagnostic tests, including blood tests, stool tests, and energetic measurements. The site offers support for various complaints, such as digestive problems, fatigue, sleep problems, reduced immunity, skin conditions, heart and vascular diseases, and hormone-related issues. Weight loss support is also offered.Alternative Medicine → Complementary Therapies 858 intestines 39 digestive issues 44 skin condition 51 orthomolecular therapy 128 sleep problems 219 diagnostics 687
kralenportal.nlKralen PortalThe article 'Plastic Frames in Monster – What are the possibilities?' describes the benefits of plastic frames, including sustainability and energy efficiency. Another section of the website addresses the negative impact of alcohol on osteoarthritis, emphasizing that excessive alcohol consumption can worsen symptoms. The website may contain other items related to beads (from the name 'Kralen Portal').Frames → Plastic Frames 340 osteoarthritis 53 alcohol 150 frames 2556 Westland → Monster 360
laatmarinaleven.nllaatmarinaleven.nlThe website provides updates on Marina Leven's health situation and her recurring trips to Barcelona for medical treatments. Information is provided about the conditions she faces, including CCI/AAI and the symptoms that limit her mobility. The website describes the efforts to cover the costs of medical treatments, including attempting a medical flight and circumventing the rejection of the health insurance.Personal & Household → Personal Situation 19 barcelona 76 health insurance 287 marina 487
liomed.nlLiomedThe website offers a PIM scan module for inventory management, which makes ordering obsolete. Liomed supplies a wide range of products to healthcare organizations, healthcare professionals, and end-users, including incontinence products, wound care materials, and ostomy supplies. Liomed Thuis delivers medical aids to homes for people who are entitled to them via their health insurance, in collaboration with healthcare professionals.Hospitality → Suppliers 1057 inventory management 138 health insurance 287 referral 377 healthcare 2316 article 6000 Netherlands → Utrecht 48901
lipoic.nlLipoic.nlAlpha lipoic acid is described as a substance that the body produces and uses to convert glucose into energy, and as a potent antioxidant. The website addresses the effects of alpha lipoic acid on various conditions, including athletic performance, weight loss, diabetes, Alzheimer's disease, and liver disorders. Alpha lipoic acid is sold as a dietary supplement in various brands, such as Ortholon, Vitals, AOV, Pharma Nord, Bonusan, Solgar, Source Naturals, NOW, Jarrow and is also used in sports supplements and weight loss pills.Nutrition → Supplements 1557 antioxidant 36 diabetes 750 supplement 1968 sport 4228
marjoleingezond.nlMarjolein GezondThe website describes Marjolein Gezond as a place where people with overweight, hormonal issues, joint problems, and fatigue can find help. Marjolein herself shares her personal experiences, emphasizing that she herself lost a significant amount of weight and overcame ailments by adjusting her diet, mindset, and lifestyle. The website explains that obesity is often related to hormonal imbalances and decreased energy production in cells, and offers individual guidance to address these issues.Physical Fitness & Exercise → Weight Loss 1147 weight 382 hormone 563 diet 747 mindset 782 lifestyle 2918 complaint 6479 Meierijstad → Veghel 1288
massagegouda.nlPraktijk ProximaalThe practice treats complaints such as migraines, globus sensation (a feeling of a lump in the throat), neck and shoulder pain, jaw tightness, and long-standing lump in the throat and chest pain, with a focus on the fascia mechanism. Treatments include classical massage, fascia treatments based on the Anatomy Trains method, and treatments for fibromyalgia and pregnancy. The website offers more than 50 testimonials and facilitates appointment scheduling via telephone or an online contact form.Pain Therapy → Pain Relief 440 fibromyalgia 43 migraine 84 neck pain 138 massage 7646 South-Holland → Gouda 3521
oedeemboek.nlOE(I)deemThe website contains a description of edema, its causes, and consequences, written in an accessible manner. Attention is paid to Therapeutic Elastic Compression Stockings (TEK) and their benefits. Instructional videos are offered to help with stimulating movement in patients with edema.Patient Services & Rights → Patient Information 158 blood vessels 23 edema 141 illustration 2447
oedeemcentrumflevoland.nlOedeemcentrum FlevolandThe center is located in Centra Plaza in Lelystad and is led by a team of five physiotherapists. Treatments are tailored to the individual and can be multidisciplinary, in collaboration with Fysiotherapie Centra Plaza Lelystad, if needed. Oedeemcentrum Flevoland emphasizes quality and follows the latest developments in physiotherapy, in accordance with the Keurmerk Fysiotherapie and quality register.Specific Conditions → Edema 19 lipoedema 20 lymphedema 24 edema 141 treatment 21203 Flevoland → Lelystad 3180
plateletgel.nlplateletgel.nlThe website features blog posts exploring various applications of PRP, including acne treatment, jaw restoration, hair loss treatment, and knee injuries. It delves into the science behind PRP, explaining its benefits and providing a guide to informed consent, often referred to as Platelet Rich Plasma or PRP. Specific articles detail PRP's use for conditions like knee chondromalacia and hip osteoarthritis, highlighting its potential as a treatment option.Health → Medical Care & Services 29461 osteoarthritis 53 hair loss 242 acne 399
pleasantdriving.nlPleasant Driving CompanyThe company is a technology startup focused on human factors for automotive applications, specializing in motion sickness solutions. Their innovations include a mobile phone application, a driving modus for automotive systems, and an integrated application for active suspension or HMI systems. The technology utilizes accelerometer data and a patented algorithm to assess the nauseating factor, considering factors such as age, gender, and habituation, and provides driver training.Transportation → Automotive Technology 315 algorithm 141 drive 428 application 3377 technology 6816
quadrivas-danielle.nlQuadrivas Therapy DanielleThe website describes Quadrivas treatments as a safe and effective way to revitalize the body. Recognized Quadrivas therapist Danielle offers personal consultations to investigate complaints and lifestyles in order to determine a suitable treatment method based on this information. The website highlights the importance of good blood circulation for health and that Quadrivas therapy may be able to heal lipoedema.Alternative Medicine → Cupping 125 lipoedema 20 circulation 155 treatment 21203 Friesland → Heerenveen 2578
rineke-rottine.nlRineke RottinéThe website describes what Pectus Excavatum is, what treatment methods are available, and the author's personal experiences with different treatment methods, such as the Nuss surgery and the Rehbein surgery. The author acknowledges that she is not an expert, but the information on the website is based on her own research and personal experiences. The website includes photos, a guestbook, a forum, and links to social media, and is managed by Joomla in Heerenveen.Patient Services & Rights → Patients 45 surgery 365
scherpensterk.nlScherp & SterkPieter van den Aarsen, the entrepreneur behind Scherp & Sterk, states that the current medical consensus often lags behind the facts. The website aims to work with users to utilize the latest scientific insights and personal expertise. Scherp & Sterk invites visitors to contact them to work together and stay ahead.Spirituality → Spiritual Guidance 226 vision 1882 nutrition 4935 health 6366
takaay.nlTakaayThe website is run by Marleen Barelds and Geert Leurink to finance Tessel, their four-year-old daughter with the rare 22q13 deletion syndrome, the opportunity to develop within her capabilities, including dolphin therapy. The project has already received support from over 300 donors and 40 helpers, allowing Tessel to travel to Curaçao for dolphin therapy. The website includes a travel report from previous therapies, a thank you video from Tessel, and information about the preparations for the trip and therapy, as well as photos from an informative booklet from the CDTC.Fundraising → Crowdfunding 22 dolphin 45 travel report 71 girl 256 donation 5110 therapy 7448
voedingstherapeuten.nlVoedingstherapeuten.nlThe website contains information about various aspects of nutrition therapy, including books and the availability of nutrition therapists. Users can find nutrition therapists based on their location, education level, and the therapies they offer, such as nutritional advice or orthomolecular nutrition therapy. The website provides an overview of nutrition therapists by province and location, with the ability to view detailed information about their practices, therapies, and educational background.Practices → Therapists 629 province 518 therapy 7448 practice 9089 education 13471 Drenthe → Hoogeveen 2294
zittendaarglutenin.nlZitten daar gluten in?The website discusses the emotional impact of receiving a celiac diagnosis on parents, sharing personal experiences from the creator, Jolien. It highlights the challenges that celiac disease presents in restaurants, schools, and recreational settings due to the need for strict gluten-free diets. The website offers free information, tools, and a children's book to support children with celiac disease and help them remain active in social life.Disease & Treatment → Allergies 157 celiac disease 12 gluten free 12 resources 310 child 11566
praktijk-wellbeing.nlWell-Being Coaching PracticeThe practice offers treatments and guidance to trace ailments back to their root cause, such as poor diet and chronic stress. The website emphasizes the importance of listening to the body's signals and discovering personal insights for a healthier life. The practice focuses on three key areas: epigenetic health scan, aromatherapy massage, and 1-on-1 coaching sessions.Alternative Medicine → Shiatsu 830 ailments 135 diet 747 body 3490 health 6366 massage 7646 coach 25810
jebestebenen.nlJe Beste BenenLinda van de Pavoordt, a manual therapist, provides programs and mobility workouts to help women with leg problems. The JBB Mobility program includes 72 diverse workouts available with a one-time payment of €99, with a risk-free two-week trial period. Linda shares her personal experience with lipoedema and her mission to help other women live a better life, despite leg problems.Body & Movement → Exercise 1005 Mental & Emotional Well-Being → Healthy Living 402 lipoedema 20 lymphedema 24 leg 59 workout 249 movement 2304
oedeemtherapiegroningen.nlFysio 4 GroningenThe website describes the different forms of edema, with explanations of the causes and symptoms of lymphedema, lipoedema, and venous edema. Oedeemtherapie Groningen provides physiotherapy for people with various edema forms and is located in multiple locations in Groningen. The website contains information about appointments, fees, reimbursement, and general terms and conditions, and offers a possibility to book an appointment online via WhatsApp.Specific Conditions → Edema 19 lymphedema 24 edema 141 physiotherapy 4688 Netherlands → Groningen 23734
fleurvdkieft.nlFleur van de Kieft CoachingThe website introduces Fleur van de Kieft Coaching as a professional, solution-oriented, and enthusiastic coaching practice. The platform describes the coaching approach as exploring qualities, obstacles, values, and passions to make confident choices. The website promotes the coaching program as a way to make targeted choices and feel more energetic and happy.Personal Development → Motivation 434 drive 428 choice 827 coach 25810